PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00127.1_g00026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 250aa    MW: 28897.2 Da    PI: 10.4067
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00127.1_g00026.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-161964147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             rg W + Ed+ l ++v+q+G+++W+ Ia+++  gR++k+c++rw++ 
  Rsa1.0_00127.1_g00026.1 19 RGHWRPIEDDHLRQLVEQYGPKNWNFIAQHLH-GRSGKSCRLRWYNQ 64
                             899*****************************.************96 PP

2Myb_DNA-binding551.9e-1771114146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              ++++T+eE+e+l++a++  G++ W++Iar ++ gRt++ +k++++ 
  Rsa1.0_00127.1_g00026.1  71 KKPFTEEEEERLLKAHRIQGNR-WASIARLFP-GRTDNAVKNHFHV 114
                              689*******************.*********.**********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5741465IPR017930Myb domain
SMARTSM007175.7E-141867IPR001005SANT/Myb domain
SuperFamilySSF466891.05E-2818112IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-262072IPR009057Homeodomain-like
CDDcd001671.08E-122263No hitNo description
PfamPF139218.9E-172282No hitNo description
PROSITE profilePS5129423.19866120IPR017930Myb domain
SMARTSM007171.5E-1470118IPR001005SANT/Myb domain
CDDcd001676.70E-1173113No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2073118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MDMSRGSNSF DNKKASCQRG HWRPIEDDHL RQLVEQYGPK NWNFIAQHLH GRSGKSCRLR  60
WYNQLDPNIT KKPFTEEEEE RLLKAHRIQG NRWASIARLF PGRTDNAVKN HFHVIMARRK  120
RESHSSTATP TFNQSWHNIL SPSSSLTRFN RSQFGLWRYQ KDKSRGFRPC TFVSGPRDDE  180
FGSSSISNVR KEVYSERRKL KELVDQHNNA LDTATPDHKK NSVEDGPSTG DDGEKKNVAF  240
IDFLGVGLVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-33191197107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896370.0AC189637.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS004O21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013660105.11e-163PREDICTED: transcriptional activator Myb-like
RefseqXP_013591863.11e-163PREDICTED: transcriptional activator Myb
TrEMBLA0A078BXD01e-163A0A078BXD0_BRANA; BnaC01g04760D protein
TrEMBLA0A0D3A2881e-163A0A0D3A288_BRAOL; Uncharacterized protein
STRINGBra011441.1-P1e-159(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101332036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33450.11e-155myb domain protein 69